
Katalognummer: 338 - MAA537Hu22-1ml-FITC
Produktkategori: Företag och industri > Vetenskap och laboratorium
Storlek: 1ml
| Additional information | Sequence of the immunogen: Ser2~Leu285+TILWSPLRTHLTRMIGLPGPSSQPCRDPDCGVMT; Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol. | 
|---|---|
| Storage and shipping | Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles. | 

By: Author , 2 Comment
23 August 2025

By: Author , 2 Comment
16 August 2025

By: Author , 2 Comment
1 August 2025

By: Author , 2 Comment
22 July 2025